PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G102500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 147aa    MW: 15639.2 Da    PI: 4.2119
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G102500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB40.75.6e-1344904894
               NF-YB 48 seasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                        s a+++c+++k+  ++gdd l a+ +lGf+dyv+pl+ yl+ y el+
  Brast07G102500.1.p 44 SLAAEQCKEQKKTILDGDDALDAMEDLGFDDYVQPLSDYLRLYHELH 90
                        56899**988888889***************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.18E-81892IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.0E-114498IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MEGRSQANDH GNDAREANLT EIMEGTLPQC PRARGAVEQS VEQSLAAEQC KEQKKTILDG  60
DDALDAMEDL GFDDYVQPLS DYLRLYHELH DLVRRDDRQP APAPPAAAVT TVEMPPPPPP  120
QPSGAAAAGA SRMPPASAAA PARDNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229874.13e-43PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like
TrEMBLI1GZ073e-43I1GZ07_BRADI; Uncharacterized protein
STRINGBRADI1G43490.19e-43(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3715422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-12nuclear factor Y, subunit B3